Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIAS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | LIAS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LIAS Polyclonal specifically detects LIAS in Human samples. It is validated for Western Blot.Specifications
| LIAS | |
| Polyclonal | |
| Rabbit | |
| O43766 | |
| 11019 | |
| Synthetic peptides corresponding to LIAS(lipoic acid synthetase) The peptide sequence was selected from the N terminal of LIAS. Peptide sequence LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.8.1.8, LASmitochondrial, LIP1, lipoic acid synthetase, Lip-syn, MGC23245 | |
| LIAS | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title