Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIAS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LIAS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LIAS Polyclonal specifically detects LIAS in Human samples. It is validated for Western Blot.Specifications
LIAS | |
Polyclonal | |
Rabbit | |
O43766 | |
11019 | |
Synthetic peptides corresponding to LIAS(lipoic acid synthetase) The peptide sequence was selected from the N terminal of LIAS. Peptide sequence LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.8.1.8, LASmitochondrial, LIP1, lipoic acid synthetase, Lip-syn, MGC23245 | |
LIAS | |
IgG | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title