Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579602

Invitrogen™ LIFR Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579602
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579602 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579602 Supplier Invitrogen™ Supplier No. PA579602
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: SW620 whole cell, COLO320 whole cell, HEPG2 whole cell.

Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LIFR
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Lifr
Gene Accession No. P42702
Gene Alias A230075M04Rik; AW061234; CD118; CD118 antigen; D-factor/LIF receptor; FLJ98106; FLJ99923; leukemia inhibitor factor receptor alpha-chain; leukemia inhibitory factor receptor; leukemia inhibitory factor receptor alpha; leukemia inhibitory factor receptor alpha chain; LIF; LIF R beta; LIF receptor; Lifr; LIF-R; SJS2; soluble differentiation-stimulating factor receptor; STWS; SWS
Gene Symbols Lifr
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR (863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3977
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.