Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIN-28A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP321298100UL
Description
LIN-28A Polyclonal antibody specifically detects LIN-28A in Human samples. It is validated for ImmunofluorescenceSpecifications
LIN-28A | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
CSDD1lin-28A, FLJ12457, LIN-28, lin-28 homolog (C. elegans), lin-28 homolog A (C. elegans), Lin-28A, LIN28RNA-binding protein LIN-28, ZCCHC1protein lin-28 homolog A, Zinc finger CCHC domain-containing protein 1, zinc finger, CCHC domain containing 1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN | |
100 μg | |
Epigenetics, Neuroscience, Stem Cell Markers, Stem Cells | |
79727 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction