Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIN9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LIN9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LIN9 Polyclonal specifically detects LIN9 in Human samples. It is validated for Western Blot.Specifications
LIN9 | |
Polyclonal | |
Rabbit | |
BARA, BARPsv, hLin-9, huLin-9, Lin-9, lin-9 homolog (C. elegans), pRB-associated protein, protein lin-9 homolog, rb related pathway actor, TGS1, TGSBeta subunit-associated regulator of apoptosis, TUDOR gene similar protein, Type I interferon receptor beta chain-associated protein | |
LIN9 | |
IgG | |
53 kDa |
Western Blot | |
Unconjugated | |
RUO | |
286826 | |
Synthetic peptide directed towards the N terminal of human LIN9The immunogen for this antibody is LIN9. Peptide sequence TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title