Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lipin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Lipin 3 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Lipin 3 Polyclonal specifically detects Lipin 3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Lipin 3 | |
Polyclonal | |
Rabbit | |
Human | |
dJ450M14.2, dJ450M14.3, dJ620E11.2, EC 3.1.3.4, lipin 3, lipin 3-like, lipin-3, Lipin-3-like, LIPN3L, phosphatidate phosphatase LPIN3, SMP2 | |
LPIN3 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
64900 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title