Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIR-6/LILRA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309438100UL
Description
LIR-6/LILRA1 Polyclonal specifically detects LIR-6/LILRA1 in Human samples. It is validated for Western Blot.Specifications
LIR-6/LILRA1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CD85 antigen-like family member I, CD85i, CD85i antigen, leukocyte immunoglobulin-like receptor subfamily A member 1, leukocyte immunoglobulin-like receptor subfamily A member 1 soluble isoform, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1, LIR-6Leukocyte immunoglobulin-like receptor 6, LIR6MGC126563 | |
The immunogen is a synthetic peptide directed towards the middle region of Human LIR-6/LILRA1. Peptide sequence FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
11024 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction