Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LMF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LMF2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LMF2 Polyclonal specifically detects LMF2 in Human samples. It is validated for Western Blot.Specifications
LMF2 | |
Polyclonal | |
Rabbit | |
Q9BU23 | |
91289 | |
Synthetic peptides corresponding to LMF2(lipase maturation factor 2) The peptide sequence was selected from the middle region of LMF2. Peptide sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
lipase maturation factor 2, TMEM153, Transmembrane protein 112BTransmembrane protein 153TMEM112B | |
LMF2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title