Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ LMO1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595417
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595417 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595417 Supplier Invitrogen™ Supplier No. PA595417
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, NIH3T3 whole cell, HELA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

LMO1 encodes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LMO1
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene LMO1
Gene Accession No. P25800, Q924W9
Gene Alias cb524; Cysteine-rich protein TTG-1; Dat1; dopamine-inducible LIM-domain transcription factor DAT1; etID41074.7; LIM domain only 1; LIM domain only 1 (rhombotin 1); LIM domain only 3; LIM domain only protein 1; LIM domain only protein 3; LIM-only 1; Lmo1; LMO-1; lmo1b; Lmo3; LMO-3; neuronal-specific transcription factor DAT1; RBTN1; Rbtn-1; RHOM1; rhombotin 1; rhombotin-1; T-cell translocation gene 1; T-cell translocation protein 1; transcription factor; Ttg1; Unknown (protein for MGC:142594); wu:fb76g02; zgc:109794
Gene Symbols LMO1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 109594, 245979, 4004
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.