Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LMO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
Antigen | LMO2 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
LMO2 Polyclonal antibody specifically detects LMO2 in Human samples. It is validated for ImmunofluorescenceSpecifications
LMO2 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Angiogenesis, Cancer | |
PBS, pH 7.2, 40% glycerol | |
4005 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Cysteine-rich protein TTG-2, LIM domain only 2 (rhombotin-like 1), LIM domain only protein 2, LMO-2, RBTN2rhombotin-2, RBTNL1rhombotin-like 1, RHOM2T-cell translocation protein 2, T-cell translocation gene 2, TTG2rhombotin 2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: FGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title