Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LMOD1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP189398 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP189398 0.1 mL
NB430717 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP189398 Supplier Novus Biologicals Supplier No. NBP189398
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

LMOD1 Polyclonal specifically detects LMOD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen LMOD1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 64 kDa autoantigen 1D, 64 kDa autoantigen 1D3,1D, 64 kDa autoantigen D1,64kD, D1, FLJ55689, leimodin 1 (smooth muscle), leiomodin 1 (smooth muscle), Leiomodin, muscle form, leiomodin-1, SM-Lmod, Smooth muscle leiomodin, thyroid and eye muscle autoantigen D1 (64kD), Thyroid-associated ophthalmopathy autoantigen
Gene Symbols LMOD1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQMPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFT
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 25802
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.