Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LMP2/PSMB9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255229
Description
LMP2/PSMB9 Polyclonal specifically detects LMP2/PSMB9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
LMP2/PSMB9 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
beta1i, LMP2MGC70470, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2), proteasome catalytic subunit 1i, Proteasome chain 7, proteasome subunit beta 6i, proteasome subunit beta type-9, Proteasome subunit beta-1i, proteasome-related gene 2, PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2), Really interesting new gene 12 protein, RING12EC 3.4.25.1 | |
Rabbit | |
Affinity Purified | |
RUO | |
5698 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PSMB9 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction