Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LMP7/PSMB8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP247396
Description
LMP7/PSMB8 Polyclonal specifically detects LMP7/PSMB8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
LMP7/PSMB8 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
beta5i, D6S216E, EC 3.4.25.1, LMP7MGC1491, Low molecular mass protein 7, low molecular weight protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, protease component C13, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7), proteasome catalytic subunit 3i, Proteasome component C13, proteasome subunit beta 5i, proteasome subunit beta type-8, Proteasome subunit beta-5i, proteasome subunit Y2, proteasome-related gene 7, PSMB5iD6S216, Really interesting new gene 10 protein, RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7), Y2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PSMB8 | |
This antibody was developed against a recombinant protein corresponding to amino acids: GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ | |
0.1 mL | |
Stem Cell Markers | |
5696 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction