Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LMX1b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | LMX1b |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LMX1b Polyclonal specifically detects LMX1b in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
LMX1b | |
Polyclonal | |
Rabbit | |
Neuroscience | |
LIM homeobox transcription factor 1, beta, LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1.2, LMX-1.2, MGC138325, MGC142051, NPS1 | |
LMX1B | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
4010 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title