Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
$461.00
Specifications
Antigen | LOC139542 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191393
|
Novus Biologicals
NBP191393 |
100 μL |
Each of 1 for $461.00
|
|
|||||
Description
LOC139542 Polyclonal specifically detects LOC139542 in Human samples. It is validated for Western Blot.Specifications
LOC139542 | |
Polyclonal | |
Rabbit | |
Human | |
LOC139542 E2F transcription factor 6 pseudogene | |
Synthetic peptide directed towards the N terminal of human hCG_1660138. Peptide sequence INPAEETVRRRDATNAECPLPSTIRINSKDDVQPESKRETVNMKPHNKTS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
139542 | |
IgG | |
Affinity Purified | |
31 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title