NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191403

Catalog No. NBP191403

Description

LOC441488 Polyclonal specifically detects LOC441488 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LOC441488
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: LOC441488 transcription factor Dp-1-like pseudogene
• Immunogen: Synthetic peptide directed towards the N terminal of human hCG_1982709. Peptide sequence GMPQRPAASNTLVVGSSHTPSTHFASQNQPSDSSPRSAGKRNRKGENCKG.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 441488
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 85%; Mouse: 85%; Canine: 86%; Rabbit: 86%; Porcine: 79%; Kenyan clawed frog: 78%; Western clawed frog: 78%; Xenopus: 78%; Guinea pig: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG