Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595306

Invitrogen™ LOXL2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595306
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595306 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595306 Supplier Invitrogen™ Supplier No. PA595306
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human MDA-MB-453 whole cell, rat brain tissue, mouse brain tissue, mouse lung tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LOXL2
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene LOXL2
Gene Accession No. B5DF27, P58022, Q9Y4K0
Gene Alias 1110004B06Rik; 4930526G11Rik; 9430067E15Rik; LOR2; Loxl2; Lysyl oxidase homolog 2; lysyl oxidase homolog 2; LOW QUALITY PROTEIN: lysyl oxidase homolog 2; lysyl oxidase like 2; lysyl oxidase related 2; lysyl oxidase-like 2; lysyl oxidase-like 2 delta e13; lysyl oxidase-like 2 protein; lysyl oxidase-like protein 2; Lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14; WS9-14
Gene Symbols LOXL2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 290350, 4017, 94352
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.