Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LPCAT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179206
Description
LPCAT2 Polyclonal specifically detects LPCAT2 in Mouse samples. It is validated for Western Blot.Specifications
LPCAT2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
1-alkylglycerophosphocholine O-acetyltransferase, Acetyl-CoA:lyso-PAF acetyltransferase, Acetyl-CoA:lyso-platelet-activating factor acetyltransferase, acyl-CoA:lysophosphatidylcholine acyltransferase 2, acyltransferase like 1, Acyltransferase-like 1, AYTL1LysoPAFAT, DKFZp686H22112, EC 2.3.1, EC 2.3.1.-, EC 2.3.1.23, EC 2.3.1.67,1-acylglycerophosphocholine O-acyltransferase, FLJ20481, LPC acyltransferase 2, LPCAT1, LPCAT-2, Lyso-PAF acetyltransferase, LysoPC acyltransferase 2, lysophosphatidylcholine acyltransferase 2, lyso-platelet-activating factor (PAF) acetyltransferase | |
Rabbit | |
Affinity purified | |
RUO | |
54947 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_766602 | |
LPCAT2 | |
The immunogen for this antibody is Lpcat2 - N-terminal region. Peptide sequence NENAQTPLVGRLLRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQIL. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Canine: 92%; Pig: 92%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction