LPCAT3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB125049	Novus Biologicals NBP310074100UL	100 μg

Description

LPCAT3 Polyclonal specifically detects LPCAT3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LPCAT3
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: 1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, C3F, EC 2.3.1.-, EC 2.3.1.23, EC 2.3.1.n6, LPCAT, LPLAT 5, Lyso-PC acyltransferase, Lyso-PC acyltransferase 3, Lysophosphatidylcholine acyltransferase, lysophosphatidylcholine acyltransferase 3LPSAT, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 5, Lyso-PS acyltransferase, MBOAT5OACT5, membrane bound O-acyltransferase domain containing 5, Membrane-bound O-acyltransferase domain-containing protein 5, nessy, O-acyltransferase (membrane bound) domain containing 5, O-acyltransferase domain-containing protein 5, putative protein similar to nessy
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPCAT3 (NP_005759.4). Peptide sequence TVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRH
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 10162
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.