Invitrogen™ LPO Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA5143855

Catalog No. PIPA5143855

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human Caco-2 whole cell. ICC/IF: Caco-2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes an oxidoreductase secreted from salivary, mammary, and other mucosal glands that functions as a natural antibacterial agent. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Antigen: LPO
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: LPO
• Gene Alias: 5830499B15Rik; airway lactoperoxidase; EC 1.11.17 antibody; lactoperoxidase; lactoperoxydase; Lpo; LPO antibody; MGC129990; MGC129991; Salivary peroxidase; SAPX; SAPX antibody; SPO; SPO antibody
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 4025
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P22079
• Gene Symbols: LPO
• Immunogen: A synthetic peptide corresponding to a sequence of human LPO (MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG