Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LPPR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169329
Description
LPPR2 Polyclonal specifically detects LPPR2 in Human samples. It is validated for Western Blot.Specifications
LPPR2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp761E1121, EC 3.1.3.4, FLJ13055, lipid phosphate phosphatase-related protein type 2, plasticity related gene 4, Plasticity-related gene 4 protein, PRG4, PRG-4 | |
Rabbit | |
37 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q96GM1 | |
LPPR2 | |
Synthetic peptides corresponding to LPPR2(lipid phosphate phosphatase-related protein type 2) The peptide sequence was selected from the middle region of LPPR2. Peptide sequence NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCA. | |
Affinity purified | |
RUO | |
64748 | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction