LRCH4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169266

Catalog No. NBP169266

Description

LRCH4 Polyclonal specifically detects LRCH4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LRCH4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ40101, FLJ46315, leucine rich repeat neuronal 4, Leucine-rich neuronal protein, leucine-rich repeat and calponin homology domain-containing protein 4, Leucine-rich repeat neuronal protein 4, leucine-rich repeats and calponin homology (CH) domain containing 4, LRN, LRRN1, LRRN4, PP14183
• Host Species: Rabbit
• Molecular Weight of Antigen: 73 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75427
• Gene Symbols: LRCH4
• Immunogen: Synthetic peptides corresponding to LRCH4(leucine-rich repeats and calponin homology (CH) domain containing 4) The peptide sequence was selected from the middle region of LRCH4. Peptide sequence DLMTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVP The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4034
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only