Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRDD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP321311100UL
Description
LRDD Polyclonal antibody specifically detects LRDD in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
LRDD | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
leucine-rich repeat and death domain-containing protein, leucine-rich repeats and death domain containing, MGC16925, p53-induced protein with a death domain, PIDD | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA | |
100 μg | |
Cell Cycle and Replication | |
55367 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction