Invitrogen™ LRIG1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595565

Catalog No. PIPA595565

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Caco-2 whole cell. IHC: human mammary cancer tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

LRIG1 protein Q96JA1 is coded by a gene on a chromosome band 3p14.3, this region is known to be deleted in various human cancers. LRIG1 is considered to be a tumor suppressor gene in humans. LRIG1 is an integral cell-surface membrane protein that is expressed by specific cells in various human tissues and that its 143-kDa form might be cleaved into 111-kDa and 32-kDa fragments. The LRIG1 protein may inhibit the growth of tumors of glial cells and the down-regulation of the LRIG1 gene may be involved in the development and progression of the tumor.

Specifications

• Antigen: LRIG1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Lrig1
• Gene Alias: D6Bwg0781e; DKFZp586O1624; Img; integral membrane glycoprotein; leucine rich repeats and immunoglobulin like domains 1; leucine-rich repeat protein LRIG1; leucine-rich repeats and immunoglobulin like domains 1; leucine-rich repeats and immunoglobulin-like domains 1; leucine-rich repeats and immunoglobulin-like domains protein 1; LIG1; LIG-1; LRIG1; ortholog of mouse integral membrane glycoprotein LIG-1
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 16206, 26018, 312574
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P70193, Q96JA1
• Gene Symbols: Lrig1
• Immunogen: A synthetic peptide corresponding to a sequence of mouse LRIG1 (AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG