Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRP-1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | LRP-1B |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
LRP-1B Polyclonal antibody specifically detects LRP-1B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
LRP-1B | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cancer | |
PBS (pH 7.2), 40% Glycerol | |
53353 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 1.1.1.94, EC 3.4.21.9, low density lipoprotein receptor related protein-deleted in tumor, low density lipoprotein receptor-related protein 1B, low density lipoprotein-related protein 1B (deleted in tumors), Low-density lipoprotein receptor-related protein-deleted in tumor, LRP-1B, LRP-deleted in tumors, LRPDIT, LRP-DITlow-density lipoprotein receptor-related protein 1B | |
This antibody was developed against a recombinant protein corresponding to amino acids: GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title