Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC31 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP324963
Description
LRRC31 Polyclonal antibody specifically detects LRRC31 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| LRRC31 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| leucine rich repeat containing 31 | |
| This antibody has been engineered to specifically recognize the recombinant protein LRRC31 using the following amino acid sequence: NVRFLKELIELDISLRPSNFRDCGQWFRHLLYAVTKLPQITEIGMKRWILPASQEEELECFDQDKKRSIHFDHGGF | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| Immunocytochemistry | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 79782 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction