Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC50 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26268525UL
Description
LRRC50 Polyclonal antibody specifically detects LRRC50 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
LRRC50 | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
CILD13, DKFZp434A119, FLJ25330, leucine rich repeat containing 50, ODA7leucine-rich repeat-containing protein 50, outer row dynein assembly 7 homolog | |
This antibody was developed against a recombinant protein corresponding to amino acids: SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK | |
25 μL | |
Cell Biology, Cytoskeleton Markers, Signal Transduction | |
123872 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction