Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC57 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LRRC57 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LRRC57 Polyclonal specifically detects LRRC57 in Human samples. It is validated for Western Blot.Specifications
LRRC57 | |
Polyclonal | |
Rabbit | |
Q8N9N7 | |
255252 | |
Synthetic peptides corresponding to LRRC57(leucine rich repeat containing 57) The peptide sequence was selected from the N terminal of LRRC57. Peptide sequence MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686H1865, FLJ36812, leucine rich repeat containing 57, leucine-rich repeat-containing protein 57 | |
LRRC57 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title