Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LRRC8B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	LRRC8B
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159628 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159628	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

LRRC8B Polyclonal specifically detects LRRC8B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	LRRC8B
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	KIAA0231TA-LRRPleucine-rich repeat-containing protein 8B, leucine rich repeat containing 8 family, member B, MGC42220, T cell activation leucine repeat rich protein, TALRRP, T-cell activation leucine repeat-rich protein
Gene Symbols	LRRC8B
Isotype	IgG
Molecular Weight of Antigen	92 kDa

Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Stem Cell Markers
Gene ID (Entrez)	23507
Immunogen	Synthetic peptides corresponding to LRRC8B(leucine rich repeat containing 8 family, member B) The peptide sequence was selected from the middle region of LRRC8B. Peptide sequence TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

LRRC8B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents