Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LRRN2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LRRN2 Polyclonal specifically detects LRRN2 in Human samples. It is validated for Western Blot.Specifications
LRRN2 | |
Polyclonal | |
Rabbit | |
O75325 | |
10446 | |
Synthetic peptides corresponding to LRRN2(leucine rich repeat neuronal 2) The peptide sequence was selected from the middle region of LRRN2. Peptide sequence RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FIGLER7, GAC1LRRN5, Glioma amplified on chromosome 1 protein, immunoglobulin and leucine rich repeat domain 7, leucine rich and ankyrin repeats 1, leucine rich repeat neuronal 2, leucine rich repeat neuronal 5, leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 5 | |
LRRN2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title