LRRN3/NLRR-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23061425UL

Catalog No. NB437501

Description

LRRN3/NLRR-3 Polyclonal specifically detects LRRN3/NLRR-3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LRRN3/NLRR-3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9H3W5
• Gene Symbols: LRRN3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FIGLER5, immunoglobulin and leucine rich repeat domains 5, leucine rich repeat neuronal 3, leucine-rich repeat neuronal protein 3, leucine-rich repeat protein, neuronal 3, Neuronal leucine-rich repeat protein 3, NLRR3, NLRR-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54674
• Target Species: Human
• Isotype: IgG

For Research Use Only