Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LRTM2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$343.50 - $573.00

Specifications

Antigen	LRTM2
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Applications	Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB170104 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31751425UL	25 μg	Each for $343.50	Only null left	Sign In or Register to check your price. Add to Cart

NB170103 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP317514100UL	100 μg	Each for $573.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

LRTM2 Polyclonal antibody specifically detects LRTM2 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	LRTM2
Applications	Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	Leucine-Rich Repeat And Transmembrane Domain-Containing Protein 2, Leucine-Rich Repeats And Transmembrane Domains 2
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: EWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKP
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	654429
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

LRTM2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents