Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ LSD1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP258483PEP

Catalog No. NBP258483PE

Add to Cart



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LSD1. Source: E.coli Amino Acid Sequence: VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY The LSD1 Recombinant Protein Antigen is derived from E. coli. The LSD1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.


LSD1 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
amine oxidase (flavin containing) domain 2, AOF2lysine-specific histone demethylase 1, BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit, Flavin-containing amine oxidase domain-containing protein 2, KIAA0601KDM1, LSD1BRAF35-HDAC complex prote
>80% by SDS-PAGE and Coomassie blue staining
Store at −20C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Recombinant Protein Antigen
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51870. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml




Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only