Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LSM14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156784
Description
LSM14A Polyclonal specifically detects LSM14A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
LSM14A | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
alphaSNBP, C19orf13, DKFZp434D1335, FAM61A, family with sequence similarity 61, member A, hRAP55, hRAP55A, LSM14 homolog A, LSM14A, SCD6 homolog A (S. cerevisiae), Protein FAM61A, protein LSM14 homolog A, Protein SCD6 homolog, Putative alpha-synuclein-binding protein, RAP55ALSM14 homolog A (SCD6, S. cerevisiae), RAP55chromosome 19 open reading frame 13, RNA-associated protein 55, RNA-associated protein 55A | |
Rabbit | |
Affinity purified | |
RUO | |
26065 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Q8ND56 | |
LSM14A | |
The immunogen is a synthetic peptide directed towards the C terminal region of human LSM14A. Peptide Sequence KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI. The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction