LSM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238093

Catalog No. NBP238093

Description

LSM2 Polyclonal specifically detects LSM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LSM2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q9Y333
• Gene Symbols: LSM2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 57819
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C6orf28chromosome 6 open reading frame 28, G7b, LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae), Protein G7b, Small nuclear ribonuclear protein D homolog, snRNP, snRNP core Sm-like protein Sm-x5, U6 snRNA-associated Sm-like protein LSm2, YBL026W
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.