Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LSM8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15708220UL
Description
LSM8 Polyclonal specifically detects LSM8 in Human samples. It is validated for Western Blot.Specifications
LSM8 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O95777 | |
NAA38 | |
Synthetic peptides corresponding to LSM8 (N(alpha)-acetyltransferase 38, NatC auxiliary subunit) The peptide sequence was selected from the N terminal of LSM8. Peptide sequence MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ. | |
Affinity Purified | |
RUO | |
51691 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FLJ33242, LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae), MAK31-like protein, N(alpha)-acetyltransferase 38, NatC auxiliary subunit, N-alpha-acetyltransferase 38, NatC auxiliary subunit, U6 small nuclear RNA associated, YJR022W | |
Rabbit | |
10 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction