Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LSM8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15708220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15708220 20 μL
NBP157082 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15708220 Supplier Novus Biologicals Supplier No. NBP15708220UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

LSM8 Polyclonal specifically detects LSM8 in Human samples. It is validated for Western Blot.

Specifications

Antigen LSM8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. O95777
Gene Alias FLJ33242, LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae), MAK31-like protein, N(alpha)-acetyltransferase 38, NatC auxiliary subunit, N-alpha-acetyltransferase 38, NatC auxiliary subunit, U6 small nuclear RNA associated, YJR022W
Gene Symbols NAA38
Host Species Rabbit
Immunogen Synthetic peptides corresponding to LSM8 (N(alpha)-acetyltransferase 38, NatC auxiliary subunit) The peptide sequence was selected from the N terminal of LSM8. Peptide sequence MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ.
Molecular Weight of Antigen 10 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51691
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.