Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LSM8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | LSM8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15708220
|
Novus Biologicals
NBP15708220UL |
20 μL |
Each for $152.22
|
|
NBP157082
|
Novus Biologicals
NBP157082 |
100 μL |
Each for $436.00
|
|
Description
LSM8 Polyclonal specifically detects LSM8 in Human samples. It is validated for Western Blot.Specifications
| LSM8 | |
| Polyclonal | |
| Rabbit | |
| O95777 | |
| 51691 | |
| Synthetic peptides corresponding to LSM8 (N(alpha)-acetyltransferase 38, NatC auxiliary subunit) The peptide sequence was selected from the N terminal of LSM8. Peptide sequence MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ33242, LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae), MAK31-like protein, N(alpha)-acetyltransferase 38, NatC auxiliary subunit, N-alpha-acetyltransferase 38, NatC auxiliary subunit, U6 small nuclear RNA associated, YJR022W | |
| NAA38 | |
| IgG | |
| Affinity Purified | |
| 10 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title