Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LST3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LST3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LST3 Polyclonal specifically detects LST3 in Human samples. It is validated for Western Blot.Specifications
LST3 | |
Polyclonal | |
Rabbit | |
Human | |
liver-specific organic anion transporter 3, liver-specific organic anion transporter 3TM12, LST3, organic anion transporter LST-3b | |
SLCO1B7 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q71QF0 | |
338821 | |
Synthetic peptides corresponding to LST-3TM12(organic anion transporter LST-3b) The peptide sequence was selected from the middle region of LST-3TM12. Peptide sequence RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title