Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LUC7L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LUC7L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LUC7L Polyclonal specifically detects LUC7L in Human samples. It is validated for Western Blot.Specifications
LUC7L | |
Polyclonal | |
Rabbit | |
NP_958815 | |
55692 | |
Synthetic peptide directed towards the N terminal of human LUC7LThe immunogen for this antibody is LUC7L. Peptide sequence YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ10231, hLuc7B1, Luc7, LUC7 (S. cerevisiae)-like, LUC7B1, LUC7L1, LUC7-LIKE, LUC7-like (S. cerevisiae), putative RNA-binding protein Luc7-like 1, Putative SR protein LUC7B1, sarcoplasmic reticulum protein LUC7B1, SR+89 | |
LUC7L | |
IgG | |
44 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title