Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LUC7L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP237852
Description
LUC7L2 Polyclonal specifically detects LUC7L2 in Human samples. It is validated for Western Blot.Specifications
| LUC7L2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CGI-59, CGI-74, FLJ10657, H_NH0792N18.3, hLuc7B2, LUC7B2, LUC7-like 2 (S. cerevisiae), putative RNA-binding protein Luc7-like 2 | |
| Rabbit | |
| 43 kDa | |
| 100 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9Y383 | |
| LUC7L2 | |
| The immunogen for Anti-LC7L2 antibody is: synthetic peptide directed towards the C-terminal region of Human LC7L2.. Peptide sequence: SRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPRDRDRKDKKRSYE | |
| Affinity purified | |
| RUO | |
| 51631 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction