Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. LUC7L2 Antibody, Novus Biologicals™

LUC7L2 Antibody, Novus Biologicals™
SDP

Catalog No. p-7110705 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP237852 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP237852 Supplier Novus Biologicals Supplier No. NBP237852
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

LUC7L2 Polyclonal specifically detects LUC7L2 in Human samples. It is validated for Western Blot.

Specifications

Antigen LUC7L2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y383
Gene Alias CGI-59, CGI-74, FLJ10657, H_NH0792N18.3, hLuc7B2, LUC7B2, LUC7-like 2 (S. cerevisiae), putative RNA-binding protein Luc7-like 2
Gene Symbols LUC7L2
Host Species Rabbit
Immunogen The immunogen for Anti-LC7L2 antibody is: synthetic peptide directed towards the C-terminal region of Human LC7L2.. Peptide sequence: SRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPRDRDRKDKKRSYE
Molecular Weight of Antigen 43 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51631
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.