Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LURAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15682320UL
Description
LURAP1 Polyclonal specifically detects LURAP1 in Human samples. It is validated for Western Blot.Specifications
LURAP1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q96LR2 | |
LURAP1 | |
Synthetic peptides corresponding to NF-kappaB activator C1orf190 The peptide sequence was selected from the middle region of NF-kappaB activator C1orf190. Peptide sequence SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 1 open reading frame 190, FLJ25163, hypothetical protein LOC541468, NF-kappaB activator C1orf190 | |
Rabbit | |
Affinity Purified | |
RUO | |
541468 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction