Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LURAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | LURAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15682320
|
Novus Biologicals
NBP15682320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156823
|
Novus Biologicals
NBP156823 |
100 μL |
Each for $487.50
|
|
|||||
Description
LURAP1 Polyclonal specifically detects LURAP1 in Human samples. It is validated for Western Blot.Specifications
| LURAP1 | |
| Polyclonal | |
| Rabbit | |
| Q96LR2 | |
| 541468 | |
| Synthetic peptides corresponding to NF-kappaB activator C1orf190 The peptide sequence was selected from the middle region of NF-kappaB activator C1orf190. Peptide sequence SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 1 open reading frame 190, FLJ25163, hypothetical protein LOC541468, NF-kappaB activator C1orf190 | |
| LURAP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title