Invitrogen™ Lyn Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595460

Catalog No. PIPA595460

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell. IHC: mouse intestine tissue, rat spleen tissue, human tonsil tissue, mouse spleen tissue, rat lymphaden tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Lyn proto oncogene (Lcl/Yes related novel protein tyrosine kinase) is encoded by the Lyn gene located on chromosome 8 in humans and belongs to the Src family kinase. It is a non-receptor tyrosine kinase that acts as a mediator in transducing cellular signaling. The most well studied expression of Lyn is in hematopoietic cell types, both lymphoid and myeloid cells with exclusion in T lymphocytes. It has also been observed that Lyn plays diverse roles such as in regulation of B cell receptor signaling, mast cell signaling and Epithelial - Mesenchymal Transition (EMT).

Specifications

• Antigen: Lyn
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: LYN
• Gene Alias: AA407514; CD180; CD180 antigen; CD180 molecule; CH73-38P6.3; FLJ26625; Hck-2; JTK8; lck/Yes-related novel protein tyrosine kinase; LY64; Ly78; lymphocyte antigen 64; lymphocyte antigen-64, radioprotective, 105kDa; LYN; lyn protein non-receptor kinase; lyn protein tyrosine kinase; LYN proto-oncogene, Src family tyrosine kinase; p53Lyn; p56Lyn; Radioprotective 105 kDa protein; RP105; Tyrosine-protein kinase Lyn; v-yes-1 Yamaguchi sarcoma viral related oncogene homolog; v-yes-1 Yamaguchi sarcoma viral related oncogene protein-like protein; Yamaguchi sarcoma viral (v-yes-1) oncogene homolog; zgc:92124
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 17096, 4067, 81515
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P07948, P25911, Q07014
• Gene Symbols: LYN
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov