Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LYPD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LYPD5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LYPD5 Polyclonal specifically detects LYPD5 in Human samples. It is validated for Western Blot.Specifications
LYPD5 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ30469, LY6/PLAUR domain containing 5, ly6/PLAUR domain-containing protein 5, metastasis-associated protein, PRO4356 | |
LYPD5 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q6UWN5-2 | |
284348 | |
Synthetic peptides corresponding to LYPD5(LY6/PLAUR domain containing 5) The peptide sequence was selected from the N terminal of LYPD5. Peptide sequence WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title