Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LYRM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LYRM1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LYRM1 Polyclonal specifically detects LYRM1 in Human samples. It is validated for Western Blot.Specifications
LYRM1 | |
Polyclonal | |
Rabbit | |
O43325 | |
57149 | |
Synthetic peptides corresponding to LYRM1(LYR motif containing 1) The peptide sequence was selected from the middle region of LYRM1. Peptide sequence KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
A211C6.1, LYR motif containing 1, LYR motif-containing protein 1 | |
LYRM1 | |
IgG | |
14 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title