Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lysosomal Pro-X Carboxypeptidase/PRCP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$607.50
Specifications
| Antigen | Lysosomal Pro-X Carboxypeptidase/PRCP |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Lysosomal Pro-X Carboxypeptidase/PRCP Polyclonal antibody specifically detects Lysosomal Pro-X Carboxypeptidase/PRCP in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| Lysosomal Pro-X Carboxypeptidase/PRCP | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS, pH 7.2, 40% glycerol | |
| 5547 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Angiotensinase C, EC 3.4.16.2, HUMPCP, Lysosomal carboxypeptidase C, lysosomal Pro-X carboxypeptidase, PCPMGC2202, Proline carboxypeptidase, Prolylcarboxypeptidase, prolylcarboxypeptidase (angiotensinase C), prolylcarboxypeptidase isoform 1 preproprotein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title