Lysyl Oxidase Homolog 2/LOXL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25673925UL

Catalog No. NB403625

Description

Lysyl Oxidase Homolog 2/LOXL2 Polyclonal specifically detects Lysyl Oxidase Homolog 2/LOXL2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Lysyl Oxidase Homolog 2/LOXL2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4017
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: LOXL2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only