Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LZTR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24964925UL
Description
LZTR1 Polyclonal antibody specifically detects LZTR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
LZTR1 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
leucine-zipper-like regulator-1, leucine-zipper-like transcription regulator 1, leucine-zipper-like transcriptional regulator 1, LZTR-1, MGC21205, TCFL2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP | |
25 μL | |
Cell Biology | |
8216 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction