Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP181039PE

Novus Biologicals™ M-Ras/R-Ras3 Protein
SDP

Catalog No. NBP181039PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP181039PE 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP181039PE Supplier Novus Biologicals™ Supplier No. NBP181039PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRAS. Source: E.coli Amino Acid Sequence: DLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL The M-Ras/R-Ras3 Recombinant Protein Antigen is derived from E. coli. The M-Ras/R-Ras3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-81039. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Gene ID (Entrez) 22808
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol MRAS
Label Type Unlabeled
Molecular Weight (g/mol) 22kDa
Product Type M-Ras/R-Ras3
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Immunogen DLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.