Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MafK Antibody, Novus Biologicals™

MafK Antibody, Novus Biologicals™
SDP

Catalog No. NBP179224 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179224 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179224 Supplier Novus Biologicals Supplier No. NBP179224
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MafK Polyclonal specifically detects MafK in Human samples. It is validated for Western Blot.

Specifications

Antigen MafK
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_002351
Gene Alias FLJ32205, MGC71717, transcription factor MafK, ubiquitous (p18), v-maf avian musculoaponeurotic fibrosarcoma oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
Gene Symbols MAFK
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human MAFKThe immunogen for this antibody is MAFK. Peptide sequence KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing, Epigenetics
Primary or Secondary Primary
Gene ID (Entrez) 7975
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Bovine: 85%; Zebrafish: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.